Lineage for d2b25b_ (2b25 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129582Family c.66.1.13: tRNA(1-methyladenosine) methyltransferase-like [64117] (5 protein domains)
    contains additional N-terminal beta-sandwich domain
  6. 2129595Protein automated matches [190496] (1 species)
    not a true protein
  7. 2129596Species Human (Homo sapiens) [TaxId:9606] [187440] (1 PDB entry)
  8. 2129597Domain d2b25b_: 2b25 B: [127700]
    Other proteins in same PDB: d2b25a1
    automated match to d2b25a1
    complexed with sam, unx

Details for d2b25b_

PDB Entry: 2b25 (more details), 2.5 Å

PDB Description: human putative trna(1-methyladenosine)methyltransferase
PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2b25b_:

Sequence, based on SEQRES records: (download)

>d2b25b_ c.66.1.13 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpfqagelilaetgegetkfkklfrlnnfgllnsnwgavpfgkivgkfpgqilrssfgkq
ymlrrpaledyvvlmkrgtaitfpkdinmilsmmdinpgdtvleagsgsggmslflskav
gsqgrvisfevrkdhhdlakknykhwrdswklshveewpdnvdfihkdisgatedikslt
fdavaldmlnphvtlpvfyphlkhggvcavyvvnitqvielldgirtcelalscekisev
ivrdwlvclakqkngilaqkveskintdvqldsqekigvkgelfqeddheeshsdfpygs
fpyvarpvhwqpghtaflvklrkv

Sequence, based on observed residues (ATOM records): (download)

>d2b25b_ c.66.1.13 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpfqagelilaetkfkklfrlnkivgkfpgqilrsqymlrrpaledyvvlmkrgtaitfp
kdinmilsmmdinpgdtvleagsgsggmslflskavgsqgrvisfevrkdhhdlakknyk
hwrdswklshveewpdnvdfihkdisgatfdavaldmlnphvtlpvfyphlkhggvcavy
vvnitqvielldgirtcelalscekisevivrdwlvclvarpvhwqpghtaflvklrkv

SCOPe Domain Coordinates for d2b25b_:

Click to download the PDB-style file with coordinates for d2b25b_.
(The format of our PDB-style files is described here.)

Timeline for d2b25b_: