Lineage for d2b24f1 (2b24 F:515-679)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718640Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 718985Superfamily d.17.4: NTF2-like [54427] (13 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 719127Family d.17.4.4: Ring hydroxylating beta subunit [54438] (4 proteins)
    Pfam PF00866
  6. 719136Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (2 species)
  7. 719156Species Rhodococcus sp. ncimb12038 [TaxId:92694] [142996] (2 PDB entries)
  8. 719162Domain d2b24f1: 2b24 F:515-679 [127698]
    Other proteins in same PDB: d2b24a1, d2b24a2, d2b24c1, d2b24c2, d2b24e1, d2b24e2
    automatically matched to 2B1X B:513-679
    complexed with fe, fes, ind

Details for d2b24f1

PDB Entry: 2b24 (more details), 3 Å

PDB Description: Crystal structure of naphthalene 1,2-dioxygenase from Rhodococcus sp. bound to indole
PDB Compounds: (F:) naphthalene dioxygenase small subunit

SCOP Domain Sequences for d2b24f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b24f1 d.17.4.4 (F:515-679) Naphthalene 1,2-dioxygenase beta subunit {Rhodococcus sp. ncimb12038 [TaxId: 92694]}
sdttvreitewlymeaelldagkyrewlalvtedlsyvvpirvtrereavtdvvegmthm
dddadsmemrvlrleteyawaedppsrsrhfvtnvrvatgdsedefkvtsnlllyrtrgd
vatydvlsgertdvlrragdsflmakrvvlldqttimthnlalim

SCOP Domain Coordinates for d2b24f1:

Click to download the PDB-style file with coordinates for d2b24f1.
(The format of our PDB-style files is described here.)

Timeline for d2b24f1: