![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.129: TBP-like [55944] (10 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (7 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins) Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1 |
![]() | Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (2 species) |
![]() | Species Rhodococcus sp. ncimb12038 [TaxId:92694] [143822] (2 PDB entries) |
![]() | Domain d2b24e2: 2b24 E:163-440 [127697] Other proteins in same PDB: d2b24a1, d2b24b1, d2b24c1, d2b24d1, d2b24e1, d2b24f1 automatically matched to 2B1X A:163-441 complexed with fe, fes, ind |
PDB Entry: 2b24 (more details), 3 Å
SCOP Domain Sequences for d2b24e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b24e2 d.129.3.3 (E:163-440) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Rhodococcus sp. ncimb12038 [TaxId: 92694]} adsledylgdlkfyldivldrsdaglqvvgapqrwvidanwklgadnfvgdayhtmmthr smvelglappdpqfalygehihtghghglgiigpppgmplpefmglpeniveelerrltp eqveifrptafihgtvfpnlsignflmgkdhlsaptafltlrlwhplgpdkmevmsfflv ekdapdwfkdesyksylrtfgisggfeqddaenwrsitrvmggqfaktgelnyqmgrgvl epdpnwtgpgeaypldyaeanqrnfleywmqlmlaesp
Timeline for d2b24e2: