SCOP 1.73: Domain d2b24e2: 2b24 E:163-440

Lineage for d2b24e2 (2b24 E:163-440)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.129: TBP-like [55944] (10 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (7 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins)
   Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1

6. Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (2 species)

7. Species Rhodococcus sp. ncimb12038 [TaxId:92694] [143822] (2 PDB entries)

8. Domain d2b24e2: 2b24 E:163-440 [127697]
   Other proteins in same PDB: d2b24a1, d2b24b1, d2b24c1, d2b24d1, d2b24e1, d2b24f1
   automatically matched to 2B1X A:163-441
   complexed with fe, fes, ind

Details for d2b24e2

PDB Entry: 2b24, 3 Å

PDB Description: Crystal structure of naphthalene 1,2-dioxygenase from Rhodococcus sp. bound to indole

PDB Compounds: (E:) naphthalene dioxygenase large subunit

SCOP Domain Sequences for d2b24e2:

Sequence; same for both SEQRES and ATOM records:

>d2b24e2 d.129.3.3 (E:163-440) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Rhodococcus sp. ncimb12038 [TaxId: 92694]}
adsledylgdlkfyldivldrsdaglqvvgapqrwvidanwklgadnfvgdayhtmmthr
smvelglappdpqfalygehihtghghglgiigpppgmplpefmglpeniveelerrltp
eqveifrptafihgtvfpnlsignflmgkdhlsaptafltlrlwhplgpdkmevmsfflv
ekdapdwfkdesyksylrtfgisggfeqddaenwrsitrvmggqfaktgelnyqmgrgvl
epdpnwtgpgeaypldyaeanqrnfleywmqlmlaesp

Timeline for d2b24e2:

• d2b24e2 is new in SCOP 1.73
  
• d2b24e2 appears in SCOP 1.75
  
• d2b24e2 appears in the current release, SCOPe 2.08