![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
![]() | Protein automated matches [190223] (5 species) not a true protein |
![]() | Species Rhodococcus sp. [TaxId:92694] [255044] (1 PDB entry) |
![]() | Domain d2b24d_: 2b24 D: [127695] Other proteins in same PDB: d2b24a1, d2b24a2, d2b24c1, d2b24c2, d2b24e1, d2b24e2 automated match to d2b1xb1 complexed with fe, fes, ind |
PDB Entry: 2b24 (more details), 3 Å
SCOPe Domain Sequences for d2b24d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b24d_ d.17.4.4 (D:) automated matches {Rhodococcus sp. [TaxId: 92694]} sdttvreitewlymeaelldagkyrewlalvtedlsyvvpirvtrereavtdvvegmthm dddadsmemrvlrleteyawaedppsrsrhfvtnvrvatgdsedefkvtsnlllyrtrgd vatydvlsgertdvlrragdsflmakrvvlldqttimthnlalim
Timeline for d2b24d_: