Class b: All beta proteins [48724] (165 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (2 families) |
Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins) |
Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (2 species) |
Species Rhodococcus sp. ncimb12038 [TaxId:92694] [141177] (2 PDB entries) |
Domain d2b24c1: 2b24 C:1-162 [127693] Other proteins in same PDB: d2b24a2, d2b24b1, d2b24c2, d2b24d1, d2b24e2, d2b24f1 automatically matched to 2B1X A:1-162 complexed with fe, fes, ind |
PDB Entry: 2b24 (more details), 3 Å
SCOP Domain Sequences for d2b24c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b24c1 b.33.1.2 (C:1-162) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Rhodococcus sp. ncimb12038 [TaxId: 92694]} mlsnelrqtlqkglhdvnsdwtvpaaiindpevhdvererifghawvflaheseipergd yvvryisedqfivcrdeggeirghlnacrhrgmqvcraemgntshfrcpyhgwtysntgs lvgvpagkdaygnqlkksdwnlrpmpnlasykglifgsldph
Timeline for d2b24c1: