Class b: All beta proteins [48724] (176 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
Protein automated matches [190701] (10 species) not a true protein |
Domain d2b24a1: 2b24 A:1-162 [127690] Other proteins in same PDB: d2b24a2, d2b24b_, d2b24c2, d2b24d_, d2b24e2, d2b24f_ automated match to d2b1xa1 complexed with fe, fes, ind |
PDB Entry: 2b24 (more details), 3 Å
SCOPe Domain Sequences for d2b24a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b24a1 b.33.1.0 (A:1-162) automated matches {Rhodococcus sp. [TaxId: 92694]} mlsnelrqtlqkglhdvnsdwtvpaaiindpevhdvererifghawvflaheseipergd yvvryisedqfivcrdeggeirghlnacrhrgmqvcraemgntshfrcpyhgwtysntgs lvgvpagkdaygnqlkksdwnlrpmpnlasykglifgsldph
Timeline for d2b24a1: