Lineage for d2b21a2 (2b21 A:65-322)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 696819Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (16 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 697007Protein DNA repair protein Rad51, catalytic domain [82412] (4 species)
  7. 697008Species Archaeon Methanococcus voltae [TaxId:2188] [110555] (8 PDB entries)
  8. 697012Domain d2b21a2: 2b21 A:65-322 [127688]
    Other proteins in same PDB: d2b21a1
    automatically matched to d1t4ga2
    complexed with anp, k, mg; mutant

Details for d2b21a2

PDB Entry: 2b21 (more details), 2.4 Å

PDB Description: rada recombinase in complex with amppnp at ph 6.0
PDB Compounds: (A:) DNA repair and recombination protein radA

SCOP Domain Sequences for d2b21a2:

Sequence, based on SEQRES records: (download)

>d2b21a2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]}
ksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscvnlqn
peflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfvarayn
sdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmatlnkl
adlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkrvaklydsp
hlpdaeaifritekgiqd

Sequence, based on observed residues (ATOM records): (download)

>d2b21a2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]}
ksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscvnlqn
peflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfvarayn
sdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmatlnkl
adlfncvvlvtnqvsghaatfrffvrkgkgdkrvaklydsphlpdaeaifritekgiqd

SCOP Domain Coordinates for d2b21a2:

Click to download the PDB-style file with coordinates for d2b21a2.
(The format of our PDB-style files is described here.)

Timeline for d2b21a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b21a1