Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.2: Carboxylesterase [53487] (7 proteins) |
Protein Enterochelin esterase, catalytic domain [142699] (1 species) |
Species Shigella flexneri [TaxId:623] [142700] (4 PDB entries) Uniprot Q83SB9 151-397 |
Domain d2b20a2: 2b20 A:151-397 [127686] Other proteins in same PDB: d2b20a1 complexed with tla |
PDB Entry: 2b20 (more details), 2.95 Å
SCOPe Domain Sequences for d2b20a2:
Sequence, based on SEQRES records: (download)
>d2b20a2 c.69.1.2 (A:151-397) Enterochelin esterase, catalytic domain {Shigella flexneri [TaxId: 623]} lqpgwdcpqapeipakeiiwkserlknsrrvwifttgdvtaeerplavlldgefwaqsmp vwpvltslthrqqlppavyvlidaidtthrahelpcnadfwlavqqellplvkviapfsd radrtvvagqsfgglsalyaglhwperfgcvlsqsgsywwphrggqqegvlleklkagev saeglrivleagirepmimranqalyaqlhpikesifwrqvdgghdalcwrgglmqglid lwqplfh
>d2b20a2 c.69.1.2 (A:151-397) Enterochelin esterase, catalytic domain {Shigella flexneri [TaxId: 623]} lqpgwdcpqapeipakeiiwkserlknsrrvwifttgdvterplavlldgefwaqsmpvw pvltslthrqqlppavyvlidaidtthrahelpcnadfwlavqqellplvkviapfsdra drtvvagqsfgglsalyaglhwperfgcvlsqsgsywwphrggqqegvlleklkagevsa eglrivleagirepmimranqalyaqlhpikesifwrqvdgghdalcwrgglmqglidlw qplfh
Timeline for d2b20a2: