Lineage for d2b20a2 (2b20 A:151-397)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134485Family c.69.1.2: Carboxylesterase [53487] (7 protein domains)
  6. 2134500Protein Enterochelin esterase, catalytic domain [142699] (1 species)
  7. 2134501Species Shigella flexneri [TaxId:623] [142700] (4 PDB entries)
    Uniprot Q83SB9 151-397
  8. 2134512Domain d2b20a2: 2b20 A:151-397 [127686]
    Other proteins in same PDB: d2b20a1
    complexed with tla

Details for d2b20a2

PDB Entry: 2b20 (more details), 2.95 Å

PDB Description: Crystal Structure of Enterochelin Esterase from Shigella flexneri Enterochelin Esterase
PDB Compounds: (A:) enterochelin esterase

SCOPe Domain Sequences for d2b20a2:

Sequence, based on SEQRES records: (download)

>d2b20a2 c.69.1.2 (A:151-397) Enterochelin esterase, catalytic domain {Shigella flexneri [TaxId: 623]}
lqpgwdcpqapeipakeiiwkserlknsrrvwifttgdvtaeerplavlldgefwaqsmp
vwpvltslthrqqlppavyvlidaidtthrahelpcnadfwlavqqellplvkviapfsd
radrtvvagqsfgglsalyaglhwperfgcvlsqsgsywwphrggqqegvlleklkagev
saeglrivleagirepmimranqalyaqlhpikesifwrqvdgghdalcwrgglmqglid
lwqplfh

Sequence, based on observed residues (ATOM records): (download)

>d2b20a2 c.69.1.2 (A:151-397) Enterochelin esterase, catalytic domain {Shigella flexneri [TaxId: 623]}
lqpgwdcpqapeipakeiiwkserlknsrrvwifttgdvterplavlldgefwaqsmpvw
pvltslthrqqlppavyvlidaidtthrahelpcnadfwlavqqellplvkviapfsdra
drtvvagqsfgglsalyaglhwperfgcvlsqsgsywwphrggqqegvlleklkagevsa
eglrivleagirepmimranqalyaqlhpikesifwrqvdgghdalcwrgglmqglidlw
qplfh

SCOPe Domain Coordinates for d2b20a2:

Click to download the PDB-style file with coordinates for d2b20a2.
(The format of our PDB-style files is described here.)

Timeline for d2b20a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b20a1