SCOP 1.73: Domain d2b20a1: 2b20 A:3-150

Lineage for d2b20a1 (2b20 A:3-150)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.20: Enterochelin esterase N-terminal domain-like [141030] (1 protein)
   PfamB 013071

6. Protein Enterochelin esterase [141031] (1 species)

7. Species Shigella flexneri [TaxId:623] [141032] (1 PDB entry)

8. Domain d2b20a1: 2b20 A:3-150 [127685]
   Other proteins in same PDB: d2b20a2
   complexed with tla

Details for d2b20a1

PDB Entry: 2b20, 2.95 Å

PDB Description: Crystal Structure of Enterochelin Esterase from Shigella flexneri Enterochelin Esterase

PDB Compounds: (A:) enterochelin esterase

SCOP Domain Sequences for d2b20a1:

Sequence, based on SEQRES records:

>d2b20a1 b.1.18.20 (A:3-150) Enterochelin esterase {Shigella flexneri [TaxId: 623]}
alkvgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhhqn
sqpqsmqriagtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpq
aiadplnpqswkgglghavsalempqap

Sequence, based on observed residues (ATOM records):

>d2b20a1 b.1.18.20 (A:3-150) Enterochelin esterase {Shigella flexneri [TaxId: 623]}
alkvgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhhqq
pqsmqriagtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpqai
adplnpqswkgglghavsalempqap

Timeline for d2b20a1:

• d2b20a1 is new in SCOP 1.73
  
• d2b20a1 appears in SCOP 1.75
  
• d2b20a1 appears in the current release, SCOPe 2.08