Lineage for d2b20a1 (2b20 A:3-150)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 659240Family b.1.18.20: Enterochelin esterase N-terminal domain-like [141030] (1 protein)
    PfamB 013071
  6. 659241Protein Enterochelin esterase [141031] (1 species)
  7. 659242Species Shigella flexneri [TaxId:623] [141032] (1 PDB entry)
  8. 659243Domain d2b20a1: 2b20 A:3-150 [127685]
    Other proteins in same PDB: d2b20a2
    complexed with tla

Details for d2b20a1

PDB Entry: 2b20 (more details), 2.95 Å

PDB Description: Crystal Structure of Enterochelin Esterase from Shigella flexneri Enterochelin Esterase
PDB Compounds: (A:) enterochelin esterase

SCOP Domain Sequences for d2b20a1:

Sequence, based on SEQRES records: (download)

>d2b20a1 b.1.18.20 (A:3-150) Enterochelin esterase {Shigella flexneri [TaxId: 623]}
alkvgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhhqn
sqpqsmqriagtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpq
aiadplnpqswkgglghavsalempqap

Sequence, based on observed residues (ATOM records): (download)

>d2b20a1 b.1.18.20 (A:3-150) Enterochelin esterase {Shigella flexneri [TaxId: 623]}
alkvgseswwqskhgpewqrlndemfevtfwwrdpqgseeystikrvwvyitgvtdhhqq
pqsmqriagtdvwqwttqlnanwrgsycfipterddifsapspdrlelregwrkllpqai
adplnpqswkgglghavsalempqap

SCOP Domain Coordinates for d2b20a1:

Click to download the PDB-style file with coordinates for d2b20a1.
(The format of our PDB-style files is described here.)

Timeline for d2b20a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b20a2