Class b: All beta proteins [48724] (180 folds) |
Fold b.156: Atu1913-like [141098] (1 superfamily) sandwich; 7 strands in two sheets, greek-key/jelly-roll; forms segment swapped dimers, swapping is probably facilitated by the helix insertion after strand 3 |
Superfamily b.156.1: Atu1913-like [141099] (1 family) automatically mapped to Pfam PF08980 |
Family b.156.1.1: Atu1913-like [141100] (1 protein) |
Protein Hypothetical protein Atu1913 [141101] (1 species) |
Species Agrobacterium tumefaciens [TaxId:358] [141102] (1 PDB entry) Uniprot Q8UE48 4-104 |
Domain d2b1ya1: 2b1y A:4-104 [127684] complexed with so4 |
PDB Entry: 2b1y (more details), 1.8 Å
SCOPe Domain Sequences for d2b1ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b1ya1 b.156.1.1 (A:4-104) Hypothetical protein Atu1913 {Agrobacterium tumefaciens [TaxId: 358]} pnfrythydlkelragttleislssvnnvrlmtganfqrftelldfkylggvakkspiri avpetmhwhliidaeghsglaessvkmlpaqpqatltrkas
Timeline for d2b1ya1: