Lineage for d2b1ya1 (2b1y A:4-104)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825255Fold b.156: Atu1913-like [141098] (1 superfamily)
    sandwich; 7 strands in two sheets, greek-key/jelly-roll; forms segment swapped dimers, swapping is probably facilitated by the helix insertion after strand 3
  4. 2825256Superfamily b.156.1: Atu1913-like [141099] (1 family) (S)
    automatically mapped to Pfam PF08980
  5. 2825257Family b.156.1.1: Atu1913-like [141100] (1 protein)
  6. 2825258Protein Hypothetical protein Atu1913 [141101] (1 species)
  7. 2825259Species Agrobacterium tumefaciens [TaxId:358] [141102] (1 PDB entry)
    Uniprot Q8UE48 4-104
  8. 2825260Domain d2b1ya1: 2b1y A:4-104 [127684]
    complexed with so4

Details for d2b1ya1

PDB Entry: 2b1y (more details), 1.8 Å

PDB Description: Crystal Structure of Protein of Unknown Function ATU1913 from Agrobacterium tumefaciens str. C58
PDB Compounds: (A:) hypothetical protein Atu1913

SCOPe Domain Sequences for d2b1ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b1ya1 b.156.1.1 (A:4-104) Hypothetical protein Atu1913 {Agrobacterium tumefaciens [TaxId: 358]}
pnfrythydlkelragttleislssvnnvrlmtganfqrftelldfkylggvakkspiri
avpetmhwhliidaeghsglaessvkmlpaqpqatltrkas

SCOPe Domain Coordinates for d2b1ya1:

Click to download the PDB-style file with coordinates for d2b1ya1.
(The format of our PDB-style files is described here.)

Timeline for d2b1ya1: