Lineage for d2b1xd_ (2b1x D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896198Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1896937Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 1896938Protein automated matches [190205] (21 species)
    not a true protein
  7. 1896986Species Rhodococcus sp. [TaxId:92694] [186958] (1 PDB entry)
  8. 1896987Domain d2b1xd_: 2b1x D: [127680]
    Other proteins in same PDB: d2b1xa1, d2b1xa2, d2b1xb1, d2b1xc1, d2b1xc2, d2b1xe1, d2b1xe2
    automated match to d1ulid_
    complexed with fe, fes, mpd

Details for d2b1xd_

PDB Entry: 2b1x (more details), 2 Å

PDB Description: Crystal structure of naphthalene 1,2-dioxygenase from Rhodococcus sp.
PDB Compounds: (D:) naphthalene dioxygenase small subunit

SCOPe Domain Sequences for d2b1xd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b1xd_ d.17.4.0 (D:) automated matches {Rhodococcus sp. [TaxId: 92694]}
rvsdttvreitewlymeaelldagkyrewlalvtedlsyvvpirvtrereavtdvvegmt
hmdddadsmemrvlrleteyawaedppsrsrhfvtnvrvatgdsedefkvtsnlllyrtr
gdvatydvlsgertdvlrragdsflmakrvvlldqttimthnlalim

SCOPe Domain Coordinates for d2b1xd_:

Click to download the PDB-style file with coordinates for d2b1xd_.
(The format of our PDB-style files is described here.)

Timeline for d2b1xd_: