Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
Protein automated matches [190205] (21 species) not a true protein |
Species Rhodococcus sp. [TaxId:92694] [186958] (1 PDB entry) |
Domain d2b1xd_: 2b1x D: [127680] Other proteins in same PDB: d2b1xa1, d2b1xa2, d2b1xb1, d2b1xc1, d2b1xc2, d2b1xe1, d2b1xe2 automated match to d1ulid_ complexed with fe, fes, mpd |
PDB Entry: 2b1x (more details), 2 Å
SCOPe Domain Sequences for d2b1xd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b1xd_ d.17.4.0 (D:) automated matches {Rhodococcus sp. [TaxId: 92694]} rvsdttvreitewlymeaelldagkyrewlalvtedlsyvvpirvtrereavtdvvegmt hmdddadsmemrvlrleteyawaedppsrsrhfvtnvrvatgdsedefkvtsnlllyrtr gdvatydvlsgertdvlrragdsflmakrvvlldqttimthnlalim
Timeline for d2b1xd_: