Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins) Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1 |
Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (2 species) |
Species Rhodococcus sp. ncimb12038 [TaxId:92694] [143822] (2 PDB entries) Uniprot Q9X3R9 163-441 |
Domain d2b1xc2: 2b1x C:163-441 [127679] Other proteins in same PDB: d2b1xa1, d2b1xb1, d2b1xc1, d2b1xd_, d2b1xe1, d2b1xf_ automatically matched to 2B1X A:163-441 complexed with fe, fes, mpd |
PDB Entry: 2b1x (more details), 2 Å
SCOPe Domain Sequences for d2b1xc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b1xc2 d.129.3.3 (C:163-441) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Rhodococcus sp. ncimb12038 [TaxId: 92694]} adsledylgdlkfyldivldrsdaglqvvgapqrwvidanwklgadnfvgdayhtmmthr smvelglappdpqfalygehihtghghglgiigpppgmplpefmglpeniveelerrltp eqveifrptafihgtvfpnlsignflmgkdhlsaptafltlrlwhplgpdkmevmsfflv ekdapdwfkdesyksylrtfgisggfeqddaenwrsitrvmggqfaktgelnyqmgrgvl epdpnwtgpgeaypldyaeanqrnfleywmqlmlaespl
Timeline for d2b1xc2: