![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (2 families) ![]() |
![]() | Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins) |
![]() | Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (2 species) |
![]() | Species Rhodococcus sp. ncimb12038 [TaxId:92694] [141177] (2 PDB entries) |
![]() | Domain d2b1xa1: 2b1x A:1-162 [127675] Other proteins in same PDB: d2b1xa2, d2b1xb1, d2b1xc2, d2b1xd1, d2b1xe2, d2b1xf1 complexed with fe, fes, mpd |
PDB Entry: 2b1x (more details), 2 Å
SCOP Domain Sequences for d2b1xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b1xa1 b.33.1.2 (A:1-162) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Rhodococcus sp. ncimb12038 [TaxId: 92694]} mlsnelrqtlqkglhdvnsdwtvpaaiindpevhdvererifghawvflaheseipergd yvvryisedqfivcrdeggeirghlnacrhrgmqvcraemgntshfrcpyhgwtysntgs lvgvpagkdaygnqlkksdwnlrpmpnlasykglifgsldph
Timeline for d2b1xa1: