Lineage for d2b1ra_ (2b1r A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527199Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 2527239Protein Sucrose-phosphatase Slr0953 [142163] (1 species)
  7. 2527240Species Synechocystis sp. PCC 6803 [TaxId:1148] [142164] (9 PDB entries)
    Uniprot P74325 1-244
  8. 2527243Domain d2b1ra_: 2b1r A: [127674]
    automated match to d1s2oa1
    complexed with cbi, mg

Details for d2b1ra_

PDB Entry: 2b1r (more details), 2.2 Å

PDB Description: x-ray structure of the sucrose-phosphatase (spp) from synechocystis sp.pcc6803 in complex with cellobiose
PDB Compounds: (A:) hypothetical protein slr0953

SCOPe Domain Sequences for d2b1ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b1ra_ c.108.1.10 (A:) Sucrose-phosphatase Slr0953 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
mrqlllisdldntwvgdqqalehlqeylgdrrgnfylayatgrsyhsarelqkqvglmep
dywltavgseiyhpegldqhwadylsehwqrdilqaiadgfealkpqspleqnpwkisyh
ldpqacptvidqltemlketgipvqvifssgkdvdllpqrsnkgnatqylqqhlamepsq
tlvcgdsgndiglfetsargvivrnaqpellhwydqwgdsrhyraqsshagaileaiahf
dfls

SCOPe Domain Coordinates for d2b1ra_:

Click to download the PDB-style file with coordinates for d2b1ra_.
(The format of our PDB-style files is described here.)

Timeline for d2b1ra_: