![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (23 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.10: Predicted hydrolases Cof [82388] (11 proteins) contains an alpha+beta subdomain inserted into a new site after strand 3 |
![]() | Protein Sucrose-phosphatase Slr0953 [142163] (1 species) |
![]() | Species Synechocystis sp. pcc 6803 [TaxId:1148] [142164] (9 PDB entries) |
![]() | Domain d2b1qa1: 2b1q A:1-244 [127673] automatically matched to 1S2O A:1-244 complexed with mg, tre |
PDB Entry: 2b1q (more details), 2.2 Å
SCOP Domain Sequences for d2b1qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b1qa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} mrqlllisdldntwvgdqqalehlqeylgdrrgnfylayatgrsyhsarelqkqvglmep dywltavgseiyhpegldqhwadylsehwqrdilqaiadgfealkpqspleqnpwkisyh ldpqacptvidqltemlketgipvqvifssgkdvdllpqrsnkgnatqylqqhlamepsq tlvcgdsgndiglfetsargvivrnaqpellhwydqwgdsrhyraqsshagaileaiahf dfls
Timeline for d2b1qa1: