Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.1: CheY-related [52173] (26 proteins) |
Protein CheY protein [52174] (5 species) |
Species Escherichia coli [TaxId:562] [52175] (42 PDB entries) Uniprot P06143 |
Domain d2b1jb_: 2b1j B: [127671] automated match to d1a0oa_ complexed with mg |
PDB Entry: 2b1j (more details), 2.4 Å
SCOPe Domain Sequences for d2b1jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b1jb_ c.23.1.1 (B:) CheY protein {Escherichia coli [TaxId: 562]} adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln kifeklgm
Timeline for d2b1jb_: