SCOPe 2.07: Domain d2b17a_: 2b17 A:

Lineage for d2b17a_ (2b17 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (27 species)
   not a true protein

7. Species Daboia russellii [TaxId:97228] [186865] (27 PDB entries)

8. Domain d2b17a_: 2b17 A: [127661]
   automated match to d1tgma_
   complexed with dif, so4

Details for d2b17a_

PDB Entry: 2b17, 2.71 Å

PDB Description: Specific binding of non-steroidal anti-inflammatory drugs (NSAIDs) to phospholipase A2: Crystal structure of the complex formed between phospholipase A2 and diclofenac at 2.7 A resolution:

PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d2b17a_:

Sequence; same for both SEQRES and ATOM records:

>d2b17a_ a.133.1.2 (A:) automated matches {Daboia russellii [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d2b17a_:

• d2b17a_ first appeared in SCOP 1.73, called d2b17a1
  
• d2b17a_ appears in SCOPe 2.06
  
• d2b17a_ appears in the current release, SCOPe 2.08