![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
![]() | Protein automated matches [190139] (27 species) not a true protein |
![]() | Species Daboia russellii [TaxId:97228] [186865] (27 PDB entries) |
![]() | Domain d2b17a_: 2b17 A: [127661] automated match to d1tgma_ complexed with dif, so4 |
PDB Entry: 2b17 (more details), 2.71 Å
SCOPe Domain Sequences for d2b17a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b17a_ a.133.1.2 (A:) automated matches {Daboia russellii [TaxId: 97228]} sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk c
Timeline for d2b17a_: