![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family) ![]() |
![]() | Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein) |
![]() | Protein Transthyretin (synonym: prealbumin) [49474] (4 species) sandwich; 8 strands in 2 sheets |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49475] (67 PDB entries) |
![]() | Domain d2b15b1: 2b15 B:10-124 [127660] automatically matched to d1bzda_ complexed with dnf, so4 |
PDB Entry: 2b15 (more details), 1.7 Å
SCOP Domain Sequences for d2b15b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b15b1 b.3.4.1 (B:10-124) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]} cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
Timeline for d2b15b1: