Lineage for d2b11c_ (2b11 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002466Family a.93.1.1: CCP-like [48114] (5 protein domains)
  6. 2002485Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 2002486Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (198 PDB entries)
    Uniprot P00431
  8. 2002660Domain d2b11c_: 2b11 C: [127655]
    Other proteins in same PDB: d2b11b1, d2b11d_
    automated match to d1koka_
    complexed with hem, znh

Details for d2b11c_

PDB Entry: 2b11 (more details), 2.3 Å

PDB Description: crystal structure of the protein-protein complex between f82w cytochrome c and cytochrome c peroxidase
PDB Compounds: (C:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d2b11c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b11c_ a.93.1.1 (C:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d2b11c_:

Click to download the PDB-style file with coordinates for d2b11c_.
(The format of our PDB-style files is described here.)

Timeline for d2b11c_: