SCOPe 2.02: Domain d2b10c_: 2b10 C:

Lineage for d2b10c_ (2b10 C:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (145 PDB entries)
   Uniprot P00431

8. Domain d2b10c_: 2b10 C: [127653]
   Other proteins in same PDB: d2b10b1, d2b10d_
   automated match to d1koka_
   complexed with hem, znh

Details for d2b10c_

PDB Entry: 2b10, 2.8 Å

PDB Description: crystal structure of the protein-protein complex between f82s cytochrome c and cytochrome c peroxidase

PDB Compounds: (C:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d2b10c_:

Sequence; same for both SEQRES and ATOM records:

>d2b10c_ a.93.1.1 (C:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d2b10c_:

• d2b10c_ first appeared in SCOP 1.73, called d2b10c1
  
• d2b10c_ appears in SCOPe 2.01
  
• d2b10c_ appears in SCOPe 2.03
  
• d2b10c_ appears in the current release, SCOPe 2.08