SCOP 1.73: Domain d2b10c1: 2b10 C:1-294

Lineage for d2b10c1 (2b10 C:1-294)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (112 PDB entries)

8. Domain d2b10c1: 2b10 C:1-294 [127653]
   automatically matched to d1koka_
   complexed with hem, znh

Details for d2b10c1

PDB Entry: 2b10, 2.8 Å

PDB Description: crystal structure of the protein-protein complex between f82s cytochrome c and cytochrome c peroxidase

PDB Compounds: (C:) Cytochrome c peroxidase, mitochondrial

SCOP Domain Sequences for d2b10c1:

Sequence; same for both SEQRES and ATOM records:

>d2b10c1 a.93.1.1 (C:1-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d2b10c1:

• d2b10c1 is new in SCOP 1.73
  
• d2b10c1 appears in SCOP 1.75
  
• d2b10c1 appears in the current release, SCOPe 2.08, called d2b10c_