Lineage for d2b0za_ (2b0z A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (206 PDB entries)
    Uniprot P00431
  8. Domain d2b0za_: 2b0z A: [127651]
    Other proteins in same PDB: d2b0zb1
    automated match to d1koka_
    complexed with hec, znh

Details for d2b0za_

PDB Entry: 2b0z (more details), 2.7 Å

PDB Description: crystal structure of the protein-protein complex between f82i cytochrome c and cytochrome c peroxidase
PDB Compounds: (A:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d2b0za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b0za_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d2b0za_ are not available.

Timeline for d2b0za_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2b0zb1