Lineage for d2b0va1 (2b0v A:4-149)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 871095Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 871096Superfamily d.113.1: Nudix [55811] (7 families) (S)
  5. 871097Family d.113.1.1: MutT-like [55812] (16 proteins)
  6. 871183Protein Hypothetical protein NE0184 [143760] (1 species)
  7. 871184Species Nitrosomonas europaea [TaxId:915] [143761] (1 PDB entry)
    Uniprot Q82XR9 4-149
  8. 871185Domain d2b0va1: 2b0v A:4-149 [127650]
    complexed with cl, edo, na

Details for d2b0va1

PDB Entry: 2b0v (more details), 1.55 Å

PDB Description: nudix hydrolase from nitrosomonas europaea.
PDB Compounds: (A:) NUDIX hydrolase

SCOP Domain Sequences for d2b0va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]}
kpnvtvaavieqddkyllveeiprgtaiklnqpaghlepgesiiqacsrevleetghsfl
pevltgiyhwtcasngttylrftfsgqvvsfdpdrkldtgivraawfsideirakqamhr
tplvmqciedyhagkrypldilqyyd

SCOP Domain Coordinates for d2b0va1:

Click to download the PDB-style file with coordinates for d2b0va1.
(The format of our PDB-style files is described here.)

Timeline for d2b0va1: