Lineage for d2b0qa1 (2b0q A:2-264)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734696Family d.144.1.6: Aminoglycoside phosphotransferases [64411] (2 proteins)
  6. 734701Protein Type IIIa 3',5"-aminoglycoside phosphotransferase [64412] (1 species)
  7. 734702Species Enterococcus faecalis [TaxId:1351] [64413] (5 PDB entries)
  8. 734708Domain d2b0qa1: 2b0q A:2-264 [127645]
    automatically matched to d1j7la_
    complexed with adp, mg, nmy

Details for d2b0qa1

PDB Entry: 2b0q (more details), 2.7 Å

PDB Description: Crystal Structure Of 3',5"-Aminoglycoside Phosphotransferase Type IIIa ADP Neomycin B Complex
PDB Compounds: (A:) Aminoglycoside 3'-phosphotransferase

SCOP Domain Sequences for d2b0qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b0qa1 d.144.1.6 (A:2-264) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]}
akmrispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverek
dmmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirl
fhsidisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpe
eelvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelf
fdllgikpdwekikyyilldelf

SCOP Domain Coordinates for d2b0qa1:

Click to download the PDB-style file with coordinates for d2b0qa1.
(The format of our PDB-style files is described here.)

Timeline for d2b0qa1: