Lineage for d2b0qa_ (2b0q A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542275Family d.144.1.6: APH phosphotransferases [64411] (5 proteins)
  6. 2542300Protein Type IIIa 3',5"-aminoglycoside phosphotransferase [64412] (1 species)
  7. 2542301Species Enterococcus faecalis [TaxId:1351] [64413] (10 PDB entries)
  8. 2542311Domain d2b0qa_: 2b0q A: [127645]
    automated match to d1j7la_
    complexed with adp, mg, nmy

Details for d2b0qa_

PDB Entry: 2b0q (more details), 2.7 Å

PDB Description: Crystal Structure Of 3',5"-Aminoglycoside Phosphotransferase Type IIIa ADP Neomycin B Complex
PDB Compounds: (A:) Aminoglycoside 3'-phosphotransferase

SCOPe Domain Sequences for d2b0qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b0qa_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]}
akmrispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverek
dmmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirl
fhsidisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpe
eelvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelf
fdllgikpdwekikyyilldelf

SCOPe Domain Coordinates for d2b0qa_:

Click to download the PDB-style file with coordinates for d2b0qa_.
(The format of our PDB-style files is described here.)

Timeline for d2b0qa_: