Lineage for d2b0lc2 (2b0l C:167-256)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694360Family a.4.5.66: CodY HTH domain [140292] (1 protein)
    Pfam PF08222
  6. 2694361Protein GTP-sensing transcriptional pleiotropic repressor CodY, C-terminal domain [140293] (1 species)
  7. 2694362Species Bacillus subtilis [TaxId:1423] [140294] (1 PDB entry)
    Uniprot P39779 167-257
  8. 2694365Domain d2b0lc2: 2b0l C:167-256 [127643]
    Other proteins in same PDB: d2b0la2, d2b0lb3, d2b0lc3
    automated match to d2b0la1

Details for d2b0lc2

PDB Entry: 2b0l (more details), 2.9 Å

PDB Description: c-terminal dna binding domain of transcriptional pleiotropic repressor cody.
PDB Compounds: (C:) GTP-sensing transcriptional pleiotropic repressor codY

SCOPe Domain Sequences for d2b0lc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b0lc2 a.4.5.66 (C:167-256) GTP-sensing transcriptional pleiotropic repressor CodY, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
mskavvqmaisslsyseleaiehifeeldgnegllvaskiadrvgitrsvivnalrkles
agviesrslgmkgtyikvlnnkflielenl

SCOPe Domain Coordinates for d2b0lc2:

Click to download the PDB-style file with coordinates for d2b0lc2.
(The format of our PDB-style files is described here.)

Timeline for d2b0lc2: