![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.66: CodY HTH domain [140292] (1 protein) Pfam PF08222 |
![]() | Protein GTP-sensing transcriptional pleiotropic repressor CodY, C-terminal domain [140293] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [140294] (1 PDB entry) Uniprot P39779 167-257 |
![]() | Domain d2b0lb2: 2b0l B:167-257 [127642] Other proteins in same PDB: d2b0la2, d2b0lb3, d2b0lc3 automated match to d2b0la1 |
PDB Entry: 2b0l (more details), 2.9 Å
SCOPe Domain Sequences for d2b0lb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b0lb2 a.4.5.66 (B:167-257) GTP-sensing transcriptional pleiotropic repressor CodY, C-terminal domain {Bacillus subtilis [TaxId: 1423]} mskavvqmaisslsyseleaiehifeeldgnegllvaskiadrvgitrsvivnalrkles agviesrslgmkgtyikvlnnkflielenlk
Timeline for d2b0lb2:
![]() Domains from other chains: (mouse over for more information) d2b0la1, d2b0la2, d2b0lc2, d2b0lc3 |