SCOPe 2.06: Domain d2b0la1: 2b0l A:167-257

Lineage for d2b0la1 (2b0l A:167-257)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.66: CodY HTH domain [140292] (1 protein)
   Pfam PF08222

6. Protein GTP-sensing transcriptional pleiotropic repressor CodY, C-terminal domain [140293] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [140294] (1 PDB entry)
   Uniprot P39779 167-257

8. Domain d2b0la1: 2b0l A:167-257 [127641]
   Other proteins in same PDB: d2b0la2, d2b0lb3, d2b0lc3

Details for d2b0la1

PDB Entry: 2b0l, 2.9 Å

PDB Description: c-terminal dna binding domain of transcriptional pleiotropic repressor cody.

PDB Compounds: (A:) GTP-sensing transcriptional pleiotropic repressor codY

SCOPe Domain Sequences for d2b0la1:

Sequence; same for both SEQRES and ATOM records:

>d2b0la1 a.4.5.66 (A:167-257) GTP-sensing transcriptional pleiotropic repressor CodY, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
mskavvqmaisslsyseleaiehifeeldgnegllvaskiadrvgitrsvivnalrkles
agviesrslgmkgtyikvlnnkflielenlk

Timeline for d2b0la1:

• d2b0la1 first appeared in SCOP 1.73
  
• d2b0la1 appears in SCOPe 2.05
  
• d2b0la1 appears in SCOPe 2.07
  
• d2b0la1 appears in the current release, SCOPe 2.08