Lineage for d2b0ja1 (2b0j A:243-344)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276308Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1276309Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1276486Family a.100.1.11: HMD dimerization domain-like [140777] (1 protein)
    dimer similar to those of the GDP-mannose 6-dehydrogenase and class I KARI domains
    automatically mapped to Pfam PF03201
  6. 1276487Protein 5,10-methenyltetrahydromethanopterin hydrogenase, HMD [140778] (1 species)
  7. 1276488Species Methanocaldococcus jannaschii [TaxId:2190] [140779] (4 PDB entries)
    Uniprot Q58194 243-344
  8. 1276492Domain d2b0ja1: 2b0j A:243-344 [127639]
    Other proteins in same PDB: d2b0ja2

Details for d2b0ja1

PDB Entry: 2b0j (more details), 1.75 Å

PDB Description: The crystal structure of the apoenzyme of the iron-sulfur-cluster-free hydrogenase (Hmd)
PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d2b0ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b0ja1 a.100.1.11 (A:243-344) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Methanocaldococcus jannaschii [TaxId: 2190]}
anligpvcdmcsavtatvyagllayrdavtkilgapadfaqmmadealtqihnlmkekgi
anmeealdpaallgtadsmcfgplaeilptalkvlekhkvve

SCOPe Domain Coordinates for d2b0ja1:

Click to download the PDB-style file with coordinates for d2b0ja1.
(The format of our PDB-style files is described here.)

Timeline for d2b0ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b0ja2