Class a: All alpha proteins [46456] (284 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.11: HMD dimerization domain-like [140777] (1 protein) dimer similar to those of the GDP-mannose 6-dehydrogenase and class I KARI domains automatically mapped to Pfam PF03201 |
Protein 5,10-methenyltetrahydromethanopterin hydrogenase, HMD [140778] (1 species) |
Species Methanocaldococcus jannaschii [TaxId:2190] [140779] (4 PDB entries) Uniprot Q58194 243-344 |
Domain d2b0ja1: 2b0j A:243-344 [127639] Other proteins in same PDB: d2b0ja2 |
PDB Entry: 2b0j (more details), 1.75 Å
SCOPe Domain Sequences for d2b0ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b0ja1 a.100.1.11 (A:243-344) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Methanocaldococcus jannaschii [TaxId: 2190]} anligpvcdmcsavtatvyagllayrdavtkilgapadfaqmmadealtqihnlmkekgi anmeealdpaallgtadsmcfgplaeilptalkvlekhkvve
Timeline for d2b0ja1: