Lineage for d2b0ha1 (2b0h A:1838-1973)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637916Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 638081Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 638120Family a.24.9.2: VBS domain [140408] (1 protein)
    Pfam PF08913; Vinculin Binding Site
  6. 638121Protein Talin 1 [140409] (1 species)
  7. 638122Species Mouse (Mus musculus) [TaxId:10090] [140410] (1 PDB entry)
  8. 638123Domain d2b0ha1: 2b0h A:1838-1973 [127638]
    3rd VBS

Details for d2b0ha1

PDB Entry: 2b0h (more details)

PDB Description: Solution structure of VBS3 fragment of talin
PDB Compounds: (A:) Talin-1

SCOP Domain Sequences for d2b0ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b0ha1 a.24.9.2 (A:1838-1973) Talin 1 {Mouse (Mus musculus) [TaxId: 10090]}
idpftmgdpegsfvdyqttmvrtakaiavtvqemvtksntspeelgplanqltsdygrla
sqakpaavaaeneeigahikhrvqelghgcsalvtkagalqcspsdvytkkeliecarrv
sekvshvlaalqagnr

SCOP Domain Coordinates for d2b0ha1:

Click to download the PDB-style file with coordinates for d2b0ha1.
(The format of our PDB-style files is described here.)

Timeline for d2b0ha1: