SCOPe 2.08: Domain d2b0ha1: 2b0h A:1843-1973

Lineage for d2b0ha1 (2b0h A:1843-1973)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families)

5. Family a.24.9.2: VBS domain [140408] (1 protein)
   Pfam PF08913; Vinculin Binding Site

6. Protein Talin 1 [140409] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140410] (1 PDB entry)
   Uniprot P26039 1838-1973

8. Domain d2b0ha1: 2b0h A:1843-1973 [127638]
   Other proteins in same PDB: d2b0ha2
   3rd VBS

Details for d2b0ha1

PDB Entry: 2b0h

PDB Description: solution structure of vbs3 fragment of talin

PDB Compounds: (A:) Talin-1

SCOPe Domain Sequences for d2b0ha1:

Sequence; same for both SEQRES and ATOM records:

>d2b0ha1 a.24.9.2 (A:1843-1973) Talin 1 {Mouse (Mus musculus) [TaxId: 10090]}
mgdpegsfvdyqttmvrtakaiavtvqemvtksntspeelgplanqltsdygrlasqakp
aavaaeneeigahikhrvqelghgcsalvtkagalqcspsdvytkkeliecarrvsekvs
hvlaalqagnr

Timeline for d2b0ha1:

• d2b0ha1 first appeared in SCOP 1.73
  
• d2b0ha1 appears in SCOPe 2.07