Lineage for d2b0eb_ (2b0e B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121131Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2121132Superfamily c.52.1: Restriction endonuclease-like [52980] (36 families) (S)
  5. 2121148Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
    automatically mapped to Pfam PF09233
  6. 2121149Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 2121150Species Escherichia coli [TaxId:562] [52986] (30 PDB entries)
  8. 2121178Domain d2b0eb_: 2b0e B: [127637]
    automated match to d1az0a_
    protein/DNA complex; complexed with ca

Details for d2b0eb_

PDB Entry: 2b0e (more details), 1.9 Å

PDB Description: EcoRV Restriction Endonuclease/GAAUTC/Ca2+
PDB Compounds: (B:) Type II restriction enzyme EcoRV

SCOPe Domain Sequences for d2b0eb_:

Sequence, based on SEQRES records: (download)

>d2b0eb_ c.52.1.2 (B:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

Sequence, based on observed residues (ATOM records): (download)

>d2b0eb_ c.52.1.2 (B:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkkikftlggytsfirnntknivyp
fdqyiahwiigyvytrvslktyninelneipkpykgvkvflqdkwviagdlagsgnttni
gsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiyrgrk

SCOPe Domain Coordinates for d2b0eb_:

Click to download the PDB-style file with coordinates for d2b0eb_.
(The format of our PDB-style files is described here.)

Timeline for d2b0eb_: