Lineage for d2b0db1 (2b0d B:2-245)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 700831Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 700832Superfamily c.52.1: Restriction endonuclease-like [52980] (31 families) (S)
  5. 700845Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein)
  6. 700846Protein Restriction endonuclease EcoRV [52985] (1 species)
  7. 700847Species Escherichia coli [TaxId:562] [52986] (29 PDB entries)
  8. 700883Domain d2b0db1: 2b0d B:2-245 [127635]
    automatically matched to d1az0a_
    complexed with ca

Details for d2b0db1

PDB Entry: 2b0d (more details), 2 Å

PDB Description: ecorv restriction endonuclease/gaattc/ca2+
PDB Compounds: (B:) Type II restriction enzyme EcoRV

SCOP Domain Sequences for d2b0db1:

Sequence, based on SEQRES records: (download)

>d2b0db1 c.52.1.2 (B:2-245) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
rgrk

Sequence, based on observed residues (ATOM records): (download)

>d2b0db1 c.52.1.2 (B:2-245) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]}
slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
iveepkqqnhypdftlykpsepnkkiaidikttytnkekikftlggytsfirnntknivy
pfdqyiahwiigyvytrvatslktyninelneipkpykgvkvflqdkwviagdlagsgnt
tnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiyrgrk

SCOP Domain Coordinates for d2b0db1:

Click to download the PDB-style file with coordinates for d2b0db1.
(The format of our PDB-style files is described here.)

Timeline for d2b0db1: