Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.2: YihX-like [56789] (3 proteins) the insertion subdomain is a 4-helical bundle automatically mapped to Pfam PF13419 |
Protein Putative phosphatase YihX [142149] (1 species) |
Species Escherichia coli [TaxId:562] [142150] (1 PDB entry) Uniprot P0A8Y3 1-197 |
Domain d2b0ca1: 2b0c A:8-204 [127633] complexed with g1p, mg |
PDB Entry: 2b0c (more details), 2 Å
SCOPe Domain Sequences for d2b0ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} mlyifdlgnvivdidfnrvlgawsdltriplaslkksfhmgeafhqhergeisdeafaea lchemalplsyeqfshgwqavfvalrpeviaimhklreqghrvvvlsntnrlhttfwpee ypeirdaadhiylsqdlgmrkpeariyqhvlqaegfspsdtvffddnadnieganqlgit silvkdkttipdyfakv
Timeline for d2b0ca1: