Lineage for d2b0ca1 (2b0c A:8-204)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2526761Family c.108.1.2: YihX-like [56789] (3 proteins)
    the insertion subdomain is a 4-helical bundle
    automatically mapped to Pfam PF13419
  6. 2526809Protein Putative phosphatase YihX [142149] (1 species)
  7. 2526810Species Escherichia coli [TaxId:562] [142150] (1 PDB entry)
    Uniprot P0A8Y3 1-197
  8. 2526811Domain d2b0ca1: 2b0c A:8-204 [127633]
    complexed with g1p, mg

Details for d2b0ca1

PDB Entry: 2b0c (more details), 2 Å

PDB Description: the crystal structure of the putative phosphatase from escherichia coli
PDB Compounds: (A:) putative phosphatase

SCOPe Domain Sequences for d2b0ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]}
mlyifdlgnvivdidfnrvlgawsdltriplaslkksfhmgeafhqhergeisdeafaea
lchemalplsyeqfshgwqavfvalrpeviaimhklreqghrvvvlsntnrlhttfwpee
ypeirdaadhiylsqdlgmrkpeariyqhvlqaegfspsdtvffddnadnieganqlgit
silvkdkttipdyfakv

SCOPe Domain Coordinates for d2b0ca1:

Click to download the PDB-style file with coordinates for d2b0ca1.
(The format of our PDB-style files is described here.)

Timeline for d2b0ca1: