SCOP 1.73: Domain d2b08a2: 2b08 A:167-337

Lineage for d2b08a2 (2b08 A:167-337)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (26 PDB entries)

8. Domain d2b08a2: 2b08 A:167-337 [127627]
   automatically matched to d1ndra2
   complexed with acm, cu1; mutant

Details for d2b08a2

PDB Entry: 2b08, 1.9 Å

PDB Description: reduced acetamide-bound m150g nitrite reductase from alcaligenes faecalis

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOP Domain Sequences for d2b08a2:

Sequence; same for both SEQRES and ATOM records:

>d2b08a2 b.6.1.3 (A:167-337) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlap

Timeline for d2b08a2:

• d2b08a2 is new in SCOP 1.73
  
• d2b08a2 appears in SCOP 1.75
  
• d2b08a2 appears in the current release, SCOPe 2.08