Lineage for d2b03a1 (2b03 A:1-124)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649171Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 649172Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 649177Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 649178Protein Phospholipase A2 [48637] (4 species)
  7. 649238Species Pig (Sus scrofa), pancreas [TaxId:9823] [48640] (19 PDB entries)
  8. 649253Domain d2b03a1: 2b03 A:1-124 [127622]
    automatically matched to d1hn4b_
    complexed with ca, tud

Details for d2b03a1

PDB Entry: 2b03 (more details), 2.3 Å

PDB Description: Crystal Structure of Porcine Pancreatic Phospholipase A2 in Complex with Taurochenodeoxycholate
PDB Compounds: (A:) phospholipase a2, major isoenzyme

SCOP Domain Sequences for d2b03a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b03a1 a.133.1.2 (A:1-124) Phospholipase A2 {Pig (Sus scrofa), pancreas [TaxId: 9823]}
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyc

SCOP Domain Coordinates for d2b03a1:

Click to download the PDB-style file with coordinates for d2b03a1.
(The format of our PDB-style files is described here.)

Timeline for d2b03a1: