Lineage for d2azya_ (2azy A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733467Species Pig (Sus scrofa) [TaxId:9823] [186957] (9 PDB entries)
  8. 2733472Domain d2azya_: 2azy A: [127618]
    automated match to d1hn4b_
    complexed with ca, chd

Details for d2azya_

PDB Entry: 2azy (more details), 1.9 Å

PDB Description: crystal structure of porcine pancreatic phospholipase a2 in complex with cholate
PDB Compounds: (A:) phospholipase a2, major isoenzyme

SCOPe Domain Sequences for d2azya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2azya_ a.133.1.2 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
kkyc

SCOPe Domain Coordinates for d2azya_:

Click to download the PDB-style file with coordinates for d2azya_.
(The format of our PDB-style files is described here.)

Timeline for d2azya_: