Lineage for d2azxb1 (2azx B:82-468)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860046Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2860140Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species)
    overall structure is similar to TyrRS
  7. 2860205Species Human (Homo sapiens) [TaxId:9606] [102256] (13 PDB entries)
    Uniprot P23381 94-471
  8. 2860221Domain d2azxb1: 2azx B:82-468 [127617]
    automatically matched to d1r6ua_
    protein/RNA complex; complexed with gol, mg, so4, trp

Details for d2azxb1

PDB Entry: 2azx (more details), 2.8 Å

PDB Description: Charged and uncharged tRNAs adopt distinct conformations when complexed with human tryptophanyl-tRNA synthetase
PDB Compounds: (B:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d2azxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2azxb1 c.26.1.1 (B:82-468) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]}
edfvdpwtvqtssakgidydklivrfgsskidkelinrieratgqrphhflrrgiffshr
dmnqvldayenkkpfylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddeky
lwkdltldqaygdavenakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfn
qvkgifgftdsdcigkisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtr
dvaprigypkpallhstffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggr
dtieehrqfggncdvdvsfmyltffledddkleqirkdytsgamltgelkkalievlqpl
iaehqarrkevtdeivkefmtprklsf

SCOPe Domain Coordinates for d2azxb1:

Click to download the PDB-style file with coordinates for d2azxb1.
(The format of our PDB-style files is described here.)

Timeline for d2azxb1: