SCOPe 2.07: Domain d2azwa1: 2azw A:2-143

Lineage for d2azwa1 (2azw A:2-143)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein Hypothetical protein EF1141 [143756] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [143757] (1 PDB entry)
   Uniprot Q836H1 2-148

8. Domain d2azwa1: 2azw A:2-143 [127615]
   Other proteins in same PDB: d2azwa2
   complexed with 1pe

Details for d2azwa1

PDB Entry: 2azw, 1.9 Å

PDB Description: Crystal structure of the MutT/nudix family protein from Enterococcus faecalis

PDB Compounds: (A:) MutT/nudix family protein

SCOPe Domain Sequences for d2azwa1:

Sequence, based on SEQRES records:

>d2azwa1 d.113.1.1 (A:2-143) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]}
ktptfgkreetltyqtryaayiivskpenntmvlvqapngayflpggeiegtetkeeaih
revleelgisveigcylgeadeyfysnhrqtayynpgyfyvantwrqlseplertntlhw
vapeeavrllkrgshrwavekw

Sequence, based on observed residues (ATOM records):

>d2azwa1 d.113.1.1 (A:2-143) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]}
ktptfgkreetltyqtryaayiivskpenntmvlvqapngayflpggeiegtetkeeaih
revleelgisveigcylgeadeyfysnhrqtayynpgyfyvantwrqlseplrtntlhwv
apeeavrllkrgshrwavekw

Timeline for d2azwa1:

• d2azwa1 first appeared in SCOP 1.73
  
• d2azwa1 appears in SCOPe 2.06