Lineage for d2azwa1 (2azw A:2-143)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535539Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2535540Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2535541Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2535685Protein Hypothetical protein EF1141 [143756] (1 species)
  7. 2535686Species Enterococcus faecalis [TaxId:1351] [143757] (1 PDB entry)
    Uniprot Q836H1 2-148
  8. 2535687Domain d2azwa1: 2azw A:2-143 [127615]
    Other proteins in same PDB: d2azwa2
    complexed with 1pe

Details for d2azwa1

PDB Entry: 2azw (more details), 1.9 Å

PDB Description: Crystal structure of the MutT/nudix family protein from Enterococcus faecalis
PDB Compounds: (A:) MutT/nudix family protein

SCOPe Domain Sequences for d2azwa1:

Sequence, based on SEQRES records: (download)

>d2azwa1 d.113.1.1 (A:2-143) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]}
ktptfgkreetltyqtryaayiivskpenntmvlvqapngayflpggeiegtetkeeaih
revleelgisveigcylgeadeyfysnhrqtayynpgyfyvantwrqlseplertntlhw
vapeeavrllkrgshrwavekw

Sequence, based on observed residues (ATOM records): (download)

>d2azwa1 d.113.1.1 (A:2-143) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]}
ktptfgkreetltyqtryaayiivskpenntmvlvqapngayflpggeiegtetkeeaih
revleelgisveigcylgeadeyfysnhrqtayynpgyfyvantwrqlseplrtntlhwv
apeeavrllkrgshrwavekw

SCOPe Domain Coordinates for d2azwa1:

Click to download the PDB-style file with coordinates for d2azwa1.
(The format of our PDB-style files is described here.)

Timeline for d2azwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2azwa2