Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (6 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
Protein Tyrosine phosphatase [52806] (7 species) |
Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (91 PDB entries) |
Domain d2azra1: 2azr A:2-298 [127614] automatically matched to d1q1ma_ complexed with 982 |
PDB Entry: 2azr (more details), 2 Å
SCOP Domain Sequences for d2azra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2azra1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed
Timeline for d2azra1: