SCOPe 2.07: Domain d2aznf_: 2azn F:

Lineage for d2aznf_ (2azn F:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.2: RibD C-terminal domain-like [142701] (3 proteins)
   Pfam PF01872

6. Protein automated matches [190490] (1 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:2190] [187432] (1 PDB entry)

8. Domain d2aznf_: 2azn F: [127613]
   Other proteins in same PDB: d2azna1
   automated match to d2azna1
   complexed with epe, ma5, nap

Details for d2aznf_

PDB Entry: 2azn, 2.7 Å

PDB Description: X-RAY Structure of 2,5-diamino-6-ribosylamino-4(3h)-pyrimidinone 5-phosphate reductase

PDB Compounds: (F:) Putative 5-amino-6-(5-phosphoribosylamino)uracil reductase

SCOPe Domain Sequences for d2aznf_:

Sequence; same for both SEQRES and ATOM records:

>d2aznf_ c.71.1.2 (F:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
ekkpyiisnvgmtldgklatinndsrisceedlirvhkiranvdgimvgigtvlkddprl
tvhkiksdrnpvrivvdsklrvplnarvlnkdaktiiattedtneekekkikiledmgve
vvkcgrgkvdlkklmdilydkgiksillegggtlnwgmfkeglvdevsvyiapkifggke
aptyvdgegfktvdecvklelknfyrlgegivlefkvkk

Timeline for d2aznf_:

• d2aznf_ first appeared in SCOP 1.73, called d2aznf1
  
• d2aznf_ appears in SCOPe 2.06
  
• d2aznf_ appears in the current release, SCOPe 2.08