Lineage for d2azne1 (2azn E:6-224)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843142Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 843143Superfamily c.71.1: Dihydrofolate reductase-like [53597] (2 families) (S)
  5. 843333Family c.71.1.2: RibD C-terminal domain-like [142701] (2 proteins)
    Pfam PF01872
  6. 843334Protein HTP reductase [142705] (1 species)
    monofunctional 5-amino-6-(5-phosphoribosylamino)uracil reductase
  7. 843335Species Methanococcus jannaschii [TaxId:2190] [142706] (1 PDB entry)
    Uniprot Q58085 6-224
  8. 843340Domain d2azne1: 2azn E:6-224 [127612]
    automatically matched to 2AZN A:6-224
    complexed with epe, ma5, nap

Details for d2azne1

PDB Entry: 2azn (more details), 2.7 Å

PDB Description: X-RAY Structure of 2,5-diamino-6-ribosylamino-4(3h)-pyrimidinone 5-phosphate reductase
PDB Compounds: (E:) Putative 5-amino-6-(5-phosphoribosylamino)uracil reductase

SCOP Domain Sequences for d2azne1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2azne1 c.71.1.2 (E:6-224) HTP reductase {Methanococcus jannaschii [TaxId: 2190]}
ekkpyiisnvgmtldgklatinndsrisceedlirvhkiranvdgimvgigtvlkddprl
tvhkiksdrnpvrivvdsklrvplnarvlnkdaktiiattedtneekekkikiledmgve
vvkcgrgkvdlkklmdilydkgiksillegggtlnwgmfkeglvdevsvyiapkifggke
aptyvdgegfktvdecvklelknfyrlgegivlefkvkk

SCOP Domain Coordinates for d2azne1:

Click to download the PDB-style file with coordinates for d2azne1.
(The format of our PDB-style files is described here.)

Timeline for d2azne1: