Lineage for d2aznd_ (2azn D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904001Family c.71.1.2: RibD C-terminal domain-like [142701] (3 proteins)
    Pfam PF01872
  6. 2904025Protein automated matches [190490] (1 species)
    not a true protein
  7. 2904026Species Methanocaldococcus jannaschii [TaxId:2190] [187432] (1 PDB entry)
  8. 2904029Domain d2aznd_: 2azn D: [127611]
    Other proteins in same PDB: d2azna1
    automated match to d2azna1
    complexed with epe, ma5, nap

Details for d2aznd_

PDB Entry: 2azn (more details), 2.7 Å

PDB Description: X-RAY Structure of 2,5-diamino-6-ribosylamino-4(3h)-pyrimidinone 5-phosphate reductase
PDB Compounds: (D:) Putative 5-amino-6-(5-phosphoribosylamino)uracil reductase

SCOPe Domain Sequences for d2aznd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aznd_ c.71.1.2 (D:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
ekkpyiisnvgmtldgklatinndsrisceedlirvhkiranvdgimvgigtvlkddprl
tvhkiksdrnpvrivvdsklrvplnarvlnkdaktiiattedtneekekkikiledmgve
vvkcgrgkvdlkklmdilydkgiksillegggtlnwgmfkeglvdevsvyiapkifggke
aptyvdgegfktvdecvklelknfyrlgegivlefkvkk

SCOPe Domain Coordinates for d2aznd_:

Click to download the PDB-style file with coordinates for d2aznd_.
(The format of our PDB-style files is described here.)

Timeline for d2aznd_: