![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.2: RibD C-terminal domain-like [142701] (3 proteins) Pfam PF01872 |
![]() | Protein automated matches [190490] (1 species) not a true protein |
![]() | Species Methanocaldococcus jannaschii [TaxId:2190] [187432] (1 PDB entry) |
![]() | Domain d2aznb_: 2azn B: [127609] Other proteins in same PDB: d2azna1 automated match to d2azna1 complexed with epe, ma5, nap |
PDB Entry: 2azn (more details), 2.7 Å
SCOPe Domain Sequences for d2aznb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aznb_ c.71.1.2 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]} ekkpyiisnvgmtldgklatinndsrisceedlirvhkiranvdgimvgigtvlkddprl tvhkiksdrnpvrivvdsklrvplnarvlnkdaktiiattedtneekekkikiledmgve vvkcgrgkvdlkklmdilydkgiksillegggtlnwgmfkeglvdevsvyiapkifggke aptyvdgegfktvdecvklelknfyrlgegivlefkvkk
Timeline for d2aznb_: