SCOP 1.73: Domain d2azna1: 2azn A:6-224

Lineage for d2azna1 (2azn A:6-224)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (2 families)

5. Family c.71.1.2: RibD C-terminal domain-like [142701] (2 proteins)
   Pfam PF01872

6. Protein HTP reductase [142705] (1 species)
   monofunctional 5-amino-6-(5-phosphoribosylamino)uracil reductase

7. Species Methanococcus jannaschii [TaxId:2190] [142706] (1 PDB entry)

8. Domain d2azna1: 2azn A:6-224 [127608]
   complexed with epe, ma5, nap

Details for d2azna1

PDB Entry: 2azn, 2.7 Å

PDB Description: X-RAY Structure of 2,5-diamino-6-ribosylamino-4(3h)-pyrimidinone 5-phosphate reductase

PDB Compounds: (A:) Putative 5-amino-6-(5-phosphoribosylamino)uracil reductase

SCOP Domain Sequences for d2azna1:

Sequence; same for both SEQRES and ATOM records:

>d2azna1 c.71.1.2 (A:6-224) HTP reductase {Methanococcus jannaschii [TaxId: 2190]}
ekkpyiisnvgmtldgklatinndsrisceedlirvhkiranvdgimvgigtvlkddprl
tvhkiksdrnpvrivvdsklrvplnarvlnkdaktiiattedtneekekkikiledmgve
vvkcgrgkvdlkklmdilydkgiksillegggtlnwgmfkeglvdevsvyiapkifggke
aptyvdgegfktvdecvklelknfyrlgegivlefkvkk

Timeline for d2azna1:

• d2azna1 is new in SCOP 1.73
  
• d2azna1 appears in SCOP 1.75
  
• d2azna1 appears in the current release, SCOPe 2.08