Lineage for d2azna1 (2azn A:6-224)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 707730Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 707731Superfamily c.71.1: Dihydrofolate reductase-like [53597] (2 families) (S)
  5. 707916Family c.71.1.2: RibD C-terminal domain-like [142701] (2 proteins)
    Pfam PF01872
  6. 707917Protein HTP reductase [142705] (1 species)
    monofunctional 5-amino-6-(5-phosphoribosylamino)uracil reductase
  7. 707918Species Methanococcus jannaschii [TaxId:2190] [142706] (1 PDB entry)
  8. 707919Domain d2azna1: 2azn A:6-224 [127608]
    complexed with epe, ma5, nap

Details for d2azna1

PDB Entry: 2azn (more details), 2.7 Å

PDB Description: X-RAY Structure of 2,5-diamino-6-ribosylamino-4(3h)-pyrimidinone 5-phosphate reductase
PDB Compounds: (A:) Putative 5-amino-6-(5-phosphoribosylamino)uracil reductase

SCOP Domain Sequences for d2azna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2azna1 c.71.1.2 (A:6-224) HTP reductase {Methanococcus jannaschii [TaxId: 2190]}
ekkpyiisnvgmtldgklatinndsrisceedlirvhkiranvdgimvgigtvlkddprl
tvhkiksdrnpvrivvdsklrvplnarvlnkdaktiiattedtneekekkikiledmgve
vvkcgrgkvdlkklmdilydkgiksillegggtlnwgmfkeglvdevsvyiapkifggke
aptyvdgegfktvdecvklelknfyrlgegivlefkvkk

SCOP Domain Coordinates for d2azna1:

Click to download the PDB-style file with coordinates for d2azna1.
(The format of our PDB-style files is described here.)

Timeline for d2azna1: