Lineage for d2azda_ (2azd A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142109Family c.87.1.4: Oligosaccharide phosphorylase [53766] (3 protein domains)
    automatically mapped to Pfam PF00343
  6. 2142250Protein automated matches [190111] (3 species)
    not a true protein
  7. 2142251Species Escherichia coli [TaxId:562] [186953] (4 PDB entries)
  8. 2142258Domain d2azda_: 2azd A: [127603]
    automated match to d1ahpa_
    complexed with plp, trs, vo4

Details for d2azda_

PDB Entry: 2azd (more details), 2.16 Å

PDB Description: x-ray studies on maltodextrin phosphorylase (malp) complexes: recognition of substrates and catalytic mechanism of phosphorylase family
PDB Compounds: (A:) maltodextrin phosphorylase

SCOPe Domain Sequences for d2azda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2azda_ c.87.1.4 (A:) automated matches {Escherichia coli [TaxId: 562]}
sqpifndkqfqealsrqwqryglnsaaemtprqwwlavsealaemlraqpfakpvanqrh
vnyismefligrltgnnllnlgwyqdvqdslkaydinltdlleeeidpalgngglgrlaa
cfldsmatvgqsatgyglnyqyglfrqsfvdgkqveapddwhrsnypwfrhnealdvqvg
iggkvtkdgrwepeftitgqawdlpvvgyrngvaqplrlwqathahpfdltkfndgdflr
aeqqginaekltkvlypndnafegkklrlmqqyfqcacsvadilrrhhlagrklhelady
eviqlndthptiaipellrvlidehqmswddawaitsktfaytnhtlmpealerwdvklv
kgllprhmqiineintrfktlvektwpgdekvwaklavvhdkqvhmanlcvvggfavngv
aalhsdlvvkdlfpeyhqlwpnkfhnvtngitprrwikqcnpalaalldkslqkewandl
dqlinlekfaddakfrqqyreikqankvrlaefvkvrtgieinpqaifdiqikrlheykr
qhlnllhilalykeirenpqadrvprvflfgakaapgyylakniifainkvadvinndpl
vgdklkvvflpdycvsaaeklipaadiseqistagkeasgtgnmklalngaltvgtldga
nveiaekvgeenififghtveqvkailakgydpvkwrkkdkvldavlkelesgkysdgdk
hafdqmlhsigkqggdpylvmadfaayveaqkqvdvlyrdqeawtraailntarcgmfss
drsirdyqariwqakr

SCOPe Domain Coordinates for d2azda_:

Click to download the PDB-style file with coordinates for d2azda_.
(The format of our PDB-style files is described here.)

Timeline for d2azda_: