Class b: All beta proteins [48724] (180 folds) |
Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) |
Family b.22.1.1: TNF-like [49843] (15 proteins) |
Protein Tumor necrosis factor (TNF) [49848] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [49849] (33 PDB entries) |
Domain d2az5d_: 2az5 D: [127602] automated match to d1tnfa_ complexed with 307 |
PDB Entry: 2az5 (more details), 2.1 Å
SCOPe Domain Sequences for d2az5d_:
Sequence, based on SEQRES records: (download)
>d2az5d_ b.22.1.1 (D:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]} dkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkgqgc psthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfqlekg drlsaeinrpdyldfaesgqvyfgiial
>d2az5d_ b.22.1.1 (D:) Tumor necrosis factor (TNF) {Human (Homo sapiens) [TaxId: 9606]} dkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfkgqgc psthvllthtisriavsyqtkvnllsaikspcqrakpwyepiylggvfqlekgdrlsaei nrpdyldfaesgqvyfgiial
Timeline for d2az5d_: