![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) ![]() |
![]() | Family d.157.1.10: beta-CASP RNA-metabolising hydrolases [143927] (4 proteins) contains insertion of a single helicase-like alpha/beta domain (from (52540)) but without the P-loop motif |
![]() | Protein Hypothetical protein EF2904 [143928] (1 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [143929] (1 PDB entry) Uniprot Q82ZZ3 5-429 |
![]() | Domain d2az4b1: 2az4 B:56-238 [127598] automatically matched to 2AZ4 A:56-238 complexed with zn fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 2az4 (more details), 2 Å
SCOPe Domain Sequences for d2az4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2az4b1 d.157.1.10 (B:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]} nnrlvpelkdlydprlgyeyhgaedkdyqhtavflshahldhsrminyldpavplytlke tkmilnslnrkgdflipspfeeknftremiglnkndvikvgeisveivpvdhdaygasal lirtpdhfitytgdlrlhghnreetlafcekakhtellmmegvsisfperepdpaqiavv see
Timeline for d2az4b1: